OpenToolslogo
ToolsExpertsSubmit a Tool
AdvertiseLearn AI
  1. home
  2. tools
  3. openwhispr
OpenWhispr screenshot

OpenWhispr

Speech to TextFree

OpenWhispr - Private Voice Dictation With Local AI

Last updated Aug 30, 2026

Claim Tool

What is OpenWhispr?

OpenWhispr is a privacy-first voice-to-text dictation app that supports both local and cloud transcription paths. The GitHub repository describes local Nvidia Parakeet and Whisper support, cloud models through bring-your-own-key access, privacy-first operation, and cross-platform availability. That makes it a practical choice for users who want dictation without automatically sending every utterance to one fixed hosted provider. The best fit is someone who writes, codes, takes notes, or drafts messages by voice and wants control over the transcription path. Local models are useful when privacy or offline-style operation matters. Bring-your-own-key cloud models are useful when a team already has provider accounts and wants higher accuracy or speed from a cloud endpoint. OpenWhispr sits between those needs by keeping the app layer open while letting users choose the model path that fits the work. Teams should evaluate OpenWhispr with real speech, accents, device microphones, and target applications before relying on it. Dictation quality depends on the model, hardware, input audio, operating system, and user workflow. The project’s value is not only raw transcription accuracy; it is also the ability to inspect an open repository, check the privacy model, and decide whether local or BYOK transcription is the right default. Pricing is simple for the app itself but variable for connected services. GitHub API metadata checked on 2026-08-30 listed OpenWhispr as an MIT-licensed JavaScript repository with 5,847 stars and 820 forks. Local use may require compatible hardware. Cloud use may create costs through the user’s own provider keys. The practical takeaway: try OpenWhispr when voice input is useful but a closed dictation service is not the right fit. It is especially relevant for privacy-conscious writers, developers, and teams that want a mix of local speech models and optional cloud transcription. A useful trial is to dictate the same passage through a local model and a cloud provider key, then compare accuracy, delay, punctuation, and correction effort. Test noisy rooms and domain-specific vocabulary, not only a clean demo sentence. Also check how copied text lands in the apps where it will actually be used. That gives a realistic view of whether OpenWhispr can replace manual typing for daily work. For teams, the governance question is simple: decide which notes can stay on local models, which tasks justify cloud transcription, and where transcripts should be stored afterward. That policy check is part of the product evaluation, because dictation tools touch raw thoughts, code snippets, meeting notes, and customer details before they become polished text.

OpenWhispr's Top Features

Key capabilities that make OpenWhispr stand out.

Voice-to-text dictation workflow

Local Nvidia Parakeet model support in project description

Local Whisper model support in project description

Bring-your-own-key cloud model option

Privacy-first product positioning

Cross-platform availability

MIT-licensed JavaScript repository

Use Cases

Who benefits most from this tool.

Privacy-conscious writers

Dictate text locally when sensitive notes should not be sent to a hosted transcription service by default.

Developers

Experiment with local and cloud speech-to-text models from an open-source desktop-style app.

Teams with provider keys

Use cloud transcription through BYOK while keeping the app layer open and auditable.

Explore Top AI Use Cases

Tags

speech-to-textdictationwhisperparakeetnvidiaprivacy-firstbyoktranscriptioncross-platformopen-source

OpenWhispr's Pricing

Free plan available

User Reviews

Share your thoughts

If you've used this product, share your thoughts with other builders

Recent reviews

Frequently Asked Questions

What is OpenWhispr?
OpenWhispr is a voice-to-text dictation app with local and cloud transcription options.
Which local models are mentioned?
The GitHub description names Nvidia Parakeet and Whisper as local model options.
Does it support cloud models?
Yes. The GitHub description says cloud models are supported through BYOK.
Is OpenWhispr open source?
Yes. GitHub API metadata lists the repository under the MIT license.

Footer

Company name

The right AI tool is out there. We'll help you find it.

LinkedInX

Knowledge Hub

  • News
  • Resources
  • Newsletter
  • Blog
  • AI Tool Reviews
  • YouTube Summary
  • YouTube Transcript Generator

Industry Hub

  • AI Companies
  • AI Tools
  • AI Models
  • MCP Servers
  • AI Tool Categories
  • Top AI Use Cases

For Builders

  • Submit a Tool
  • Experts & Agencies
  • Advertise
  • Compare Tools
  • Favourites

Legal

  • Privacy Policy
  • Terms of Service

© 2026 OpenTools - All rights reserved.